PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G266400.1.p
Common NameLOC101769616, SETIT_007179mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 243aa    MW: 27077.3 Da    PI: 7.5349
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G266400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.59.4e-311871255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        pr+rWt+eLH++Fveave LGG+++AtPk+il+lm+vkg++++h+kSHLQ+YR+
  Seita.4G266400.1.p 18 PRMRWTEELHRQFVEAVECLGGQDEATPKRILQLMGVKGVSISHIKSHLQMYRS 71
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3921474IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-291472IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-241871IPR006447Myb domain, plants
SuperFamilySSF466894.93E-171873IPR009057Homeodomain-like
PfamPF002496.2E-91970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MRGFERKGVR QYNRSEVPRM RWTEELHRQF VEAVECLGGQ DEATPKRILQ LMGVKGVSIS  60
HIKSHLQMYR SSSNSSTHQS SLHKSTSTSD SKRVFLNRED HCIYASPDGN TPASDRNIYA  120
MFRGCSHSSP YQIPSLQEVF RSWEQSRGRV PWDSNVLTIE QAVRPRSHTT CNMMKPEKQT  180
GCDLTLSIGL WEDASSDADG SSTISEELPA PAAGARCVAT VKEEESKPAL NLDLTISSSW  240
LA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4067632e-87CU406763.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C005B16, full insert sequence.
GenBankEU9560372e-87EU956037.1 Zea mays clone 1555999 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966301.10.0PREDICTED: uncharacterized protein LOC101769616
TrEMBLK3XZ210.0K3XZ21_SETIT; Uncharacterized protein
STRINGSi007179m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54933758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.15e-26G2-like family protein